Peptide LexiconAll compounds

IGF-1: The 70-Residue Hormone Behind Growth Hormone — and Mecasermin, Its Approved Copy

IGF-1 (insulin-like growth factor 1) is a 70-amino-acid protein hormone that the body makes in response to growth hormone, and a link in the chain through which growth hormone drives growth. Its approved copy, mecasermin (Increlex), treats a rare group of children who make too little of it — and its commonest side effect in trials was low blood sugar.

Made by the body70 amino acids — a small proteinApproved as mecasermin (Increlex, 2005)

Caroline S · Published 2026-10-05

Length

70 amino acids in a single chain, held by three internal disulfide bridges; molecular weight 7,649 Da (Increlex label)

Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA — residues 49–118 of a 195-residue precursor that also carries a signal peptide and an 'E peptide' tail (UniProt P05019). Mecasermin's sequence is identical (Increlex label)

Origin

Made by the body in response to growth hormone (UniProt P10912 describes the failure to make it when the growth-hormone receptor is broken). Mecasermin is the same protein made in E. coli bacteria carrying the human gene (Increlex label); Ipsen's Increlex was approved on 2005-08-30 (BLA 021839)

Last reviewed

2026-10-05

What is it good for?

In the body, carrying growth hormone's message to growing bone and other tissues. As a medicine, one narrow use: growth failure in children aged 2 and over with severe primary IGF-1 deficiency — very short, very low IGF-1, but normal or high growth hormone — or with a deleted growth-hormone gene and antibodies that block replacement growth hormone. The label says it is not a substitute for growth hormone.

Illustration: Clear glass vials with pale crystalline powder and a copper spoon on a white lab bench.
Illustration

What it is

IGF-1 is a 70-amino-acid protein, not a short peptide. The Increlex label describes it as a single chain held in shape by three internal disulfide bridges, weighing 7,649 Da. UniProt (P05019) shows it is cut from a 195-residue precursor: a signal peptide at the front, a short propeptide, the 70-residue hormone, then a 77-residue tail called the E peptide.

It is also called somatomedin C. The "insulin-like" in its name is structural — it resembles insulin — and the label's commonest side effect shows the resemblance is functional too.

How it works

Growth hormone does not drive growth alone: it triggers production of IGF-1, which UniProt describes as related to insulin in structure and function but with much higher growth-promoting activity. In blood, the label states, more than 80% of IGF-1 travels bound to IGF binding protein 3 and a partner called the acid-labile subunit, which slows its clearance.

That is why severe primary IGF-1 deficiency is its own condition. The children have normal or high growth hormone but cannot turn it into IGF-1 — most in the label's trials had Laron syndrome, which UniProt (P10912) describes as a dysfunctional growth-hormone receptor and a failure to generate IGF-1 in response to growth hormone. Giving more growth hormone does nothing; giving IGF-1 bypasses the broken step.

Measure (Increlex label) Figure
Bioavailability under the skin, healthy adults Close to 100%
Half-life, children with the deficiency (0.12 mg/kg) 5.8 hours
Where it is broken down Liver and kidney

The trial record

The label pools five studies — four open-label, one placebo-controlled — in 71 children with severe primary IGF-1 deficiency. At the start they averaged 6.7 years old, 84.8 cm tall and 6.7 standard deviations below average height. Of the 61 with at least a year of treatment, 53 had Laron syndrome, 7 a growth-hormone gene deletion and 1 neutralising antibodies.

Year of treatment Children Height velocity (cm/year) Change from pre-treatment p
Before 58 2.8 — —
1 58 8.0 +5.2 < 0.0001
2 48 5.8 +2.9 < 0.0001
4 23 4.7 +1.5 0.0045
8 13 4.3 +0.7 0.31

Two limits sit in that table: the comparison is each child against their own past, not against an untreated group, and the number followed shrinks from 58 to 13. Height stayed far below average — the mean standard-deviation score moved from −6.7 to −5.2 by year 8.

Safety

The label's warnings come from IGF-1 acting like insulin and like a growth signal:

  • Low blood sugar — 30 of 71 children (42%) at least once; 5 needed help, 4 had seizures or lost consciousness. It was most frequent in the first month and in younger children.
  • Tonsil and adenoid growth — 11 children (15%); 7 had them removed.
  • Raised pressure inside the skull in three children, slipped capital femoral epiphysis, worsening scoliosis.
  • Malignant tumours reported after marketing. The label says a link is unknown, that most cases were in children with cancer-predisposing conditions, and that they were seen more often at doses lifting IGF-1 above the normal range.
  • Benzyl alcohol in the vial, which the label ties to fatal "gasping syndrome" in infants.

Where it stands

Mecasermin is approved in the US for the one paediatric indication above. Drugs@FDA lists Increlex (BLA 021839, 2005-08-30) as a prescription product; a second form, Iplex (mecasermin rinfabate, BLA 021884, 2005-12-12), is listed as discontinued (openFDA, 2026-10-05). The label requires supervision by a physician experienced in these children; dose is set by weight and adjusted against blood sugar. PubMed indexes 103 records for mecasermin, 5 tagged as randomised controlled trials (2026-10-05).

No adult use is approved. Claims made for IGF-1 in muscle building or anti-ageing rest on no trial in this label.

The modified research compound sold under a similar name has its own entry as IGF-1 LR3. The growth-hormone releasers tesamorelin, sermorelin and ipamorelin raise IGF-1 indirectly, by raising growth hormone first, while drugs such as lanreotide are judged partly by how far they push it down in acromegaly.

What the research shows

Raises growth rate in children with severe primary IGF-1 deficiency

FDA-approved indication. Label: five studies (four open-label, one placebo-controlled) pooled across 71 children; height velocity rose from 2.8 to 8.0 cm a year in year 1 (58 children), and the gain over pre-treatment narrowed each year after

Builds muscle or slows ageing in adults

Not an approved use. The label's trials enrolled only children with the deficiency; no adult indication exists

Bars show how much of the evidence is in humans, not how well anything works.

Where it stands

United States

Approved for one paediatric indication. Drugs@FDA lists Increlex (BLA 021839, Ipsen, 2005-08-30) as a prescription product and a second mecasermin, Iplex (mecasermin rinfabate, Insmed, BLA 021884, 2005-12-12), as discontinued (openFDA, 2026-10-05). The current label (2026-05-18) names Eton Pharmaceuticals for adverse-event reports.

How it is given

Under the skin twice a day, within 20 minutes of a meal or snack; the label says a dose is withheld if the child cannot eat, and that it must never be given into a vein.

Published record

PubMed indexes 103 records for 'mecasermin', 5 tagged as randomised controlled trials (2026-10-05).

Frequently asked questions

What is IGF-1?

Insulin-like growth factor 1, a 70-amino-acid protein hormone made in response to growth hormone. UniProt describes the IGFs as structurally and functionally related to insulin but with much higher growth-promoting activity — hence the name.

What is IGF-1 used for as a medicine?

Only one thing on the US label: growth failure in children aged 2 and over with severe primary IGF-1 deficiency, or with a deleted growth-hormone gene and antibodies against replacement growth hormone. The approved product is mecasermin, sold as Increlex.

Is IGF-1 the same as IGF-1 LR3?

No. IGF-1 LR3 is a lengthened, altered research compound with 83 amino acids that binds the IGF binding proteins poorly. Mecasermin is the unaltered 70-residue human sequence. They have separate entries in this library.

What does an IGF-1 blood test show?

It is used as a readout of growth-hormone activity. The lanreotide and octreotide labels, for example, use IGF-1 alongside growth hormone to judge acromegaly control. Interpreting a result for a particular person is a clinician's job.

What are the main side effects of mecasermin?

On the label: low blood sugar (42% of trial children at least once), tonsil and adenoid enlargement, raised pressure inside the skull, slipped growth plates at the hip, worsening scoliosis, allergic reactions including anaphylaxis, and reported malignant tumours.

Why must Increlex be given with food?

Because IGF-1 lowers blood sugar the way insulin does. The label sets the injection within 20 minutes before or after a meal or snack and says the dose is skipped if the child cannot eat.