Peptide LexiconAll compounds

Teduglutide: GLP-2 With One Letter Changed — the Gut-Growth Peptide for Short Bowel Syndrome

Teduglutide (Gattex) is a 33-amino-acid copy of the gut hormone GLP-2 with a single swap — glycine for alanine at position 2 — that shields it from the enzyme DPP-4. Approved in 2012 for short bowel syndrome, it helps the remaining intestine absorb more, cutting intravenous feeding. Its label requires colonoscopy because it can speed the growth of polyps.

FDA-approved (2012)Short bowel syndromeNo generic approved

Caroline S · Published 2026-09-28

Length

33 amino acids; molecular weight 3,752 daltons (Gattex label)

Sequence

HGDGSFSDEMNTILDNLAARDFINWLIQTKITD — identical to human GLP-2 except glycine at position 2, where the hormone has alanine (Gattex label sequence compared with UniProt P01275, residues 146–178)

Origin

A recombinant analogue of human glucagon-like peptide-2, made in genetically modified E. coli. Gattex (NDA203441) was approved 2012-12-21 according to FDA application data; Takeda holds the application

Last reviewed

2026-09-28

What is it good for?

Short bowel syndrome in adults and children aged 1 and over who depend on intravenous (parenteral) nutrition. It makes the remaining gut absorb more, so fewer litres of intravenous feeding are needed each week.

Illustration: An abstract molecular model of a peptide chain in white and deep green on a white surface.
Illustration

What it is

Teduglutide is a 33-amino-acid copy of glucagon-like peptide-2 (GLP-2), a hormone released by L-cells in the lower small intestine after a meal. It is sold as Gattex, approved in the US on 21 December 2012. It treats short bowel syndrome: what remains when surgery, Crohn's disease or loss of blood supply has taken away so much intestine that a person cannot absorb enough food and water and depends on intravenous feeding.

It is made by bacteria, not by chemical synthesis: the label describes production in a genetically modified strain of E. coli. Its molecular weight is 3,752 daltons.

The one-letter change

Laying the Gattex label's sequence beside the GLP-2 segment of human proglucagon (UniProt P01275, residues 146–178) shows 33 positions, 32 identical:

Position 1 2 3 4 5 … 33
Human GLP-2 H A (alanine) D G identical
Teduglutide H G (glycine) D G identical

Position 2 matters because DPP-4, an enzyme in blood, cuts peptides that carry an alanine there and inactivates natural GLP-2 quickly. Glycine resists it. The result, per the label: a half-life of about 2 hours, bioavailability under the skin of 88%, and a drug that works once a day.

How it works

GLP-2 and GLP-1 are cut from the same precursor protein, proglucagon, yet do different jobs. GLP-1 acts on appetite and insulin. GLP-2 acts on the gut itself: the Gattex label describes receptors on enteroendocrine cells, the myofibroblasts beneath the lining, and gut nerves, whose activation releases IGF-1, nitric oxide and keratinocyte growth factor. The label also notes that GLP-2 increases blood flow to the gut and reduces stomach acid. The net effect is a taller, more absorptive lining — more surface from the intestine that is left.

The evidence

Study 1 (Gattex label) Teduglutide (n = 43) Placebo (n = 43)
Cut weekly IV feeding by ≥20% at weeks 20 and 24 63% 30%
Mean weekly IV volume reduction at week 24 4.4 L (from 12.9 L) 2.3 L (from 13.2 L)
Cut at least one infusion day per week 54% 23%

The adults in the trial had depended on intravenous feeding for a mean of 6 years, with a mean 77 cm of small intestine left. The trial ran 24 weeks and then continued as an open-label extension. The drug reduces dependence on infusions; the label's trial does not claim it ends dependence for most patients.

Doses on the label

Reported as the Gattex label states it, not as guidance: 0.05 mg per kilogram, injected under the skin once daily, for adults and children. Each vial holds 5 mg of powder. The label advises against the 5 mg kit in children under 10 kg.

Safety

The label's lead warning is acceleration of neoplastic growth: a drug that grows gut tissue can also grow polyps and tumours, a concern backed by rodent carcinogenicity findings. It therefore requires colonoscopy and upper endoscopy with polyp removal within 6 months before adults start, repeated after 1 year and then at intervals; for children it starts with stool blood testing. Other warnings cover intestinal obstruction, gallbladder and pancreatic disease, and fluid overload. The commonest effects were abdominal pain, nausea, upper respiratory infection, abdominal distension and injection-site reactions.

Where it stands

FDA application data list the 5 mg kit as a current prescription product, with no generic (2026-09-28). ClinicalTrials.gov holds 50 records with teduglutide as an intervention; Europe PMC's MEDLINE index holds 348 records naming it, 22 tagged as randomised controlled trials.

Teduglutide's closest relative hormone is GLP-1, whose drugs include the daily injection liraglutide and semaglutide; both hormones come from the same precursor as glucagon. For another gut-acting peptide in the library, see larazotide, an oral peptide tested to tighten the gut barrier in coeliac disease.

What the research shows

Reduces the intravenous feeding needed in short bowel syndrome

Study 1, 86 adults, 24 weeks, placebo-controlled: 63% vs 30% achieved at least a 20% cut in weekly parenteral volume (Gattex label)

Allows some patients to drop infusion days

Same trial: 54% vs 23% cut at least one infusion day a week (Gattex label)

Can speed the growth of intestinal polyps and tumours

Label warning based on the drug's action and rodent carcinogenicity findings; colonoscopy required before and during treatment (Gattex label)

Bars show how much of the evidence is in humans, not how well anything works.

Where it stands

United States

Approved 2012 (NDA203441), extended to children aged 1 and over. FDA application data list the 5 mg kit as a current prescription product and no generic application (2026-09-28). The current label is dated 2025-09-05.

Trial registry

50 ClinicalTrials.gov records list teduglutide as an intervention (2026-09-28).

Published record

Europe PMC's MEDLINE index holds 348 records with teduglutide in the title or abstract, 22 tagged as randomised controlled trials (2026-09-28).

Frequently asked questions

What is teduglutide?

A 33-amino-acid synthetic version of GLP-2, a hormone made by cells in the lower small intestine. Sold as Gattex, it treats short bowel syndrome in people who depend on intravenous nutrition.

How is teduglutide different from natural GLP-2?

By one amino acid: glycine at position 2 instead of alanine. That is the spot where the enzyme DPP-4 cuts natural GLP-2 quickly. The swap lets teduglutide last about 2 hours, long enough for a once-daily injection.

Is teduglutide a GLP-1 drug?

No. GLP-1 and GLP-2 are related hormones cut from the same precursor, proglucagon, but act on different receptors. GLP-1 drugs such as semaglutide act on appetite and blood sugar; teduglutide acts on the gut lining, helping it grow and absorb.

Why does teduglutide need colonoscopies?

Because it makes intestinal tissue grow, it can also speed the growth of polyps and tumours. Its label requires colonoscopy and upper endoscopy with polyp removal before adults start, again after one year, and at intervals after that.

What dose of teduglutide is on the label?

The Gattex label states 0.05 mg per kilogram of body weight, injected under the skin once daily, for adults and children. This is reported from the label, not as guidance.

What are the side effects of teduglutide?

The label's commonest effects (10% or more) are abdominal pain, nausea, upper respiratory infection, abdominal distension, injection-site reactions, vomiting, fluid overload and hypersensitivity. Serious warnings cover neoplastic growth, intestinal obstruction, gallbladder and pancreatic disease, and fluid overload.